| Class b: All beta proteins [48724] (180 folds) |
| Fold b.7: C2 domain-like [49561] (5 superfamilies) sandwich; 8 strands in 2 sheets; greek-key |
Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (4 families) ![]() two constituent families are related by circular permutation |
| Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (11 proteins) topologically similar to the C-terminal domain of PapD |
| Protein Synaptogamin I [49576] (3 species) duplication: contains tandem repeat of two similar domains |
| Species Norway rat (Rattus norvegicus) [TaxId:10116] [49577] (12 PDB entries) Uniprot P21707 271-419 ! Uniprot P21707 271-419 |
| Domain d1rsya1: 1rsy A:140-265 [23192] Other proteins in same PDB: d1rsya2 first C2 domain CASP1 complexed with so4 |
PDB Entry: 1rsy (more details), 1.9 Å
SCOPe Domain Sequences for d1rsya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rsya1 b.7.1.2 (A:140-265) Synaptogamin I {Norway rat (Rattus norvegicus) [TaxId: 10116]}
eklgklqysldydfqnnqllvgiiqaaelpaldmggtsdpyvkvfllpdkkkkfetkvhr
ktlnpvfneqftfkvpyselggktlvmavydfdrfskhdiigefkvpmntvdfghvteew
rdlqsa
Timeline for d1rsya1: