SCOPe 2.08: Domain d1rsya1: 1rsy A:140-265

Lineage for d1rsya1 (1rsy A:140-265)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.7: C2 domain-like [49561] (5 superfamilies)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (4 families)
   two constituent families are related by circular permutation

5. Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (11 proteins)
   topologically similar to the C-terminal domain of PapD

6. Protein Synaptogamin I [49576] (3 species)
   duplication: contains tandem repeat of two similar domains

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [49577] (12 PDB entries)
   Uniprot P21707 271-419 ! Uniprot P21707 271-419

8. Domain d1rsya1: 1rsy A:140-265 [23192]
   Other proteins in same PDB: d1rsya2
   first C2 domain
   CASP1
   complexed with so4

Details for d1rsya1

PDB Entry: 1rsy, 1.9 Å

PDB Description: structure of the first c2-domain of synaptotagmin i: a novel ca2+(slash)phospholipid binding fold

PDB Compounds: (A:) Synaptotagmin I

SCOPe Domain Sequences for d1rsya1:

Sequence; same for both SEQRES and ATOM records:

>d1rsya1 b.7.1.2 (A:140-265) Synaptogamin I {Norway rat (Rattus norvegicus) [TaxId: 10116]}
eklgklqysldydfqnnqllvgiiqaaelpaldmggtsdpyvkvfllpdkkkkfetkvhr
ktlnpvfneqftfkvpyselggktlvmavydfdrfskhdiigefkvpmntvdfghvteew
rdlqsa

Timeline for d1rsya1:

• d1rsya1 first appeared (with stable ids) in SCOP 1.55, called d1rsy__
  
• d1rsya1 appears in SCOPe 2.07