SCOPe 2.08: Domain d3czua_: 3czu A:

Lineage for d3czua_ (3czu A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families)

5. Family b.18.1.0: automated matches [191481] (1 protein)
   not a true family

6. Protein automated matches [190770] (51 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188939] (29 PDB entries)

8. Domain d3czua_: 3czu A: [231917]
   Other proteins in same PDB: d3czub_
   automated match to d3etpa_

Details for d3czua_

PDB Entry: 3czu, 2.65 Å

PDB Description: crystal structure of the human ephrin a2- ephrin a1 complex

PDB Compounds: (A:) Ephrin type-A receptor 2

SCOPe Domain Sequences for d3czua_:

Sequence; same for both SEQRES and ATOM records:

>d3czua_ b.18.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kevvlldfaaaggelgwlthpygkgwdlmqnimndmpiymysvcnvmsgdqdnwlrtnwv
yrgeaerifielkftvrdcnsfpggasscketfnlyyaesdldygtnfqkrlftkidtia
pdeitvssdfearhvklnveersvgpltrkgfylafqdigacvallsvrvyykkc

Timeline for d3czua_:

• d3czua_ first appeared in SCOPe 2.03
  
• d3czua_ appears in SCOPe 2.07