SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3czma1 (3czm A:16-163)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2093044Family c.2.1.5: LDH N-terminal domain-like [51848] (9 protein domains)
  6. 2093083Protein Lactate dehydrogenase [51859] (18 species)
  7. 2093300Species Toxoplasma gondii [TaxId:5811] [102166] (5 PDB entries)
  8. 2093314Domain d3czma1: 3czm A:16-163 [231915]
    Other proteins in same PDB: d3czma2, d3czmb2
    automated match to d1pzga1
    complexed with nad, oxq

Details for d3czma1

PDB Entry: 3czm (more details), 2.3 Å

PDB Description: T. Gondii bradyzoite-specific LDH (LDH2) in complex with NAD and OXQ
PDB Compounds: (A:) l-lactate dehydrogenase

SCOPe Domain Sequences for d3czma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3czma1 c.2.1.5 (A:16-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]}
tvsrrkkiamigsgmiggtmgylcvlreladvvlfdvvtgmpegkalddsqatsiadtnv
svtsanqyekiagsdvviitagltkvpgksdkewsrndllpfnakiirevaqgvkkycpl
afvivvtnpldcmvkcfheasglpknmvcgm

SCOPe Domain Coordinates for d3czma1:

Click to download the PDB-style file with coordinates for d3czma1.
(The format of our PDB-style files is described here.)

Timeline for d3czma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3czma2