SCOPe 2.05: Domain d3cz5a_: 3cz5 A:

Lineage for d3cz5a_ (3cz5 A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.0: automated matches [191324] (1 protein)
   not a true family

6. Protein automated matches [190131] (59 species)
   not a true protein

7. Species Aurantimonas sp. [TaxId:314269] [231910] (1 PDB entry)

8. Domain d3cz5a_: 3cz5 A: [231911]
   automated match to d4e7ob_
   complexed with po4

Details for d3cz5a_

PDB Entry: 3cz5, 2.7 Å

PDB Description: crystal structure of two-component response regulator, luxr family, from aurantimonas sp. si85-9a1

PDB Compounds: (A:) Two-component response regulator, LuxR family

SCOPe Domain Sequences for d3cz5a_:

Sequence; same for both SEQRES and ATOM records:

>d3cz5a_ c.23.1.0 (A:) automated matches {Aurantimonas sp. [TaxId: 314269]}
starimlvddhpivregyrrlierrpgyavvaeaadageayrlyrettpdivvmdltlpg
pggieatrhirqwdgaariliftmhqgsafalkafeagasgyvtkssdpaelvqaieail
agrramspdiaqeiaeerveg

Timeline for d3cz5a_:

• d3cz5a_ first appeared in SCOPe 2.03
  
• d3cz5a_ appears in SCOPe 2.04
  
• d3cz5a_ appears in SCOPe 2.06
  
• d3cz5a_ appears in the current release, SCOPe 2.08