| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) ![]() |
| Family c.23.1.0: automated matches [191324] (1 protein) not a true family |
| Protein automated matches [190131] (48 species) not a true protein |
| Species Aurantimonas sp. [TaxId:314269] [231910] (1 PDB entry) |
| Domain d3cz5a_: 3cz5 A: [231911] automated match to d4e7ob_ complexed with po4 |
PDB Entry: 3cz5 (more details), 2.7 Å
SCOPe Domain Sequences for d3cz5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cz5a_ c.23.1.0 (A:) automated matches {Aurantimonas sp. [TaxId: 314269]}
starimlvddhpivregyrrlierrpgyavvaeaadageayrlyrettpdivvmdltlpg
pggieatrhirqwdgaariliftmhqgsafalkafeagasgyvtkssdpaelvqaieail
agrramspdiaqeiaeerveg
Timeline for d3cz5a_: