| Class b: All beta proteins [48724] (180 folds) |
| Fold b.7: C2 domain-like [49561] (5 superfamilies) sandwich; 8 strands in 2 sheets; greek-key |
Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (4 families) ![]() two constituent families are related by circular permutation |
| Family b.7.1.1: PLC-like (P variant) [49563] (12 proteins) |
| Protein Domain from protein kinase C delta [49573] (1 species) rudiment form lacking calcium-binding site |
| Species Norway rat (Rattus norvegicus) [TaxId:10116] [49574] (1 PDB entry) |
| Domain d1bdyb_: 1bdy B: [23191] has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1bdy (more details), 2.2 Å
SCOPe Domain Sequences for d1bdyb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bdyb_ b.7.1.1 (B:) Domain from protein kinase C delta {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mapflrisfnsyelgslqaeddasqpfcavkmkealttdrgktlvqkkptmypewkstfd
ahiyegrviqivlmraaedpmsevtvgvsvlaerckknngkaefwldlqpqakvlmcvqy
fle
Timeline for d1bdyb_: