SCOPe 2.05: Domain d3cs3a_: 3cs3 A:

Lineage for d3cs3a_ (3cs3 A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   parallel beta-sheet of 6 strands, order 213456

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families)
   Similar in architecture to the superfamily II but partly differs in topology

5. Family c.93.1.0: automated matches [191439] (1 protein)
   not a true family

6. Protein automated matches [190646] (60 species)
   not a true protein

7. Species Enterococcus faecalis [TaxId:226185] [231906] (2 PDB entries)

8. Domain d3cs3a_: 3cs3 A: [231907]
   automated match to d3egca_
   complexed with gol, so4

Details for d3cs3a_

PDB Entry: 3cs3, 2.4 Å

PDB Description: crystal structure of sugar-binding transcriptional regulator (laci family) from enterococcus faecalis

PDB Compounds: (A:) Sugar-binding transcriptional regulator, LacI family

SCOPe Domain Sequences for d3cs3a_:

Sequence; same for both SEQRES and ATOM records:

>d3cs3a_ c.93.1.0 (A:) automated matches {Enterococcus faecalis [TaxId: 226185]}
krrqtniigvyladyggsfygellegikkglalfdyemivcsgkkshlfipekmvdgaii
ldwtfptkeiekfaerghsivvldrttehrnirqvlldnrggatqaieqfvnvgskkvll
lsgpekgydsqerlavstreltrfgipyeiiqgdftepsgyaaakkilsqpqtepvdvfa
fndemaigvykyvaetnyqmgkdiriigfdnselgafvqprlatiayskhrwgmvaaeki
ihlmrgeaaesehiytrfiegesfps

Timeline for d3cs3a_:

• d3cs3a_ first appeared in SCOPe 2.03
  
• d3cs3a_ appears in SCOPe 2.04
  
• d3cs3a_ appears in SCOPe 2.06
  
• d3cs3a_ appears in the current release, SCOPe 2.08