Class b: All beta proteins [48724] (180 folds) |
Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies) sandwich of half-barrel shaped beta-sheets |
Superfamily b.84.1: Single hybrid motif [51230] (2 families) 7 to 8 strands in 2 beta-sheets |
Family b.84.1.1: Biotinyl/lipoyl-carrier proteins and domains [51231] (7 proteins) |
Protein Lipoyl domain of dihydrolipoamide acetyltransferase [51238] (5 species) component of the pyruvate dehydrogenase complex |
Species Human (Homo sapiens) [TaxId:9606] [51242] (8 PDB entries) |
Domain d3crld_: 3crl D: [231905] Other proteins in same PDB: d3crla1, d3crla2, d3crlb1, d3crlb2 automated match to d2q8ib_ complexed with anp, k, mg |
PDB Entry: 3crl (more details), 2.61 Å
SCOPe Domain Sequences for d3crld_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3crld_ b.84.1.1 (D:) Lipoyl domain of dihydrolipoamide acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} sypphmqvllpalsptmtmgtvqrwekkvgeklsegdllaeietdkatigfevqeegyla kilvpegtrdvplgtplciivekeadi
Timeline for d3crld_: