SCOPe 2.07: Domain d3crkc_: 3crk C:

Lineage for d3crkc_ (3crk C:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
   sandwich of half-barrel shaped beta-sheets

4. Superfamily b.84.1: Single hybrid motif [51230] (2 families)
   7 to 8 strands in 2 beta-sheets

5. Family b.84.1.1: Biotinyl/lipoyl-carrier proteins and domains [51231] (7 proteins)

6. Protein Lipoyl domain of dihydrolipoamide acetyltransferase [51238] (5 species)
   component of the pyruvate dehydrogenase complex

7. Species Human (Homo sapiens) [TaxId:9606] [51242] (8 PDB entries)

8. Domain d3crkc_: 3crk C: [231902]
   Other proteins in same PDB: d3crka1, d3crka2, d3crkb1, d3crkb2
   automated match to d2q8ib_
   complexed with k

Details for d3crkc_

PDB Entry: 3crk, 2.3 Å

PDB Description: crystal structure of the pdhk2-l2 complex.

PDB Compounds: (C:) Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial

SCOPe Domain Sequences for d3crkc_:

Sequence; same for both SEQRES and ATOM records:

>d3crkc_ b.84.1.1 (C:) Lipoyl domain of dihydrolipoamide acetyltransferase {Human (Homo sapiens) [TaxId: 9606]}
sypphmqvllpalsptmtmgtvqrwekkvgeklsegdllaeietdkatigfevqeegyla
kilvpegtrdvplgtplciivekeadi

Timeline for d3crkc_:

• d3crkc_ first appeared in SCOPe 2.03
  
• d3crkc_ appears in SCOPe 2.06
  
• d3crkc_ appears in the current release, SCOPe 2.08