SCOPe 2.07: Domain d3cq6e_: 3cq6 E:

Lineage for d3cq6e_ (3cq6 E:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.0: automated matches [191328] (1 protein)
   not a true family

6. Protein automated matches [190151] (160 species)
   not a true protein

7. Species Corynebacterium glutamicum [231893] (3 PDB entries)

8. Domain d3cq6e_: 3cq6 E: [231900]
   automated match to d3hdoa_
   complexed with po4

Details for d3cq6e_

PDB Entry: 3cq6, 2.1 Å

PDB Description: Histidinol-phosphate aminotransferase from Corynebacterium glutamicum holo-form (PLP covalently bound )

PDB Compounds: (E:) Histidinol-phosphate aminotransferase

SCOPe Domain Sequences for d3cq6e_:

Sequence; same for both SEQRES and ATOM records:

>d3cq6e_ c.67.1.0 (E:) automated matches {Corynebacterium glutamicum}
kitlsdlplreelrgehaygapqlnvdirlntnenpyppsealvadlvatvdkiatelnr
yperdavelrdelaayitkqtgvavtrdnlwaangsneilqqllqafggpgrtalgfqps
ysmhpilakgthtefiavsrgadfridmdvaleeirakqpdivfvttpnnptgdvtsldd
veriinvapgivivdeayaefspspsattllekyptklvvsrtmskafdfaggrlgyfva
npafidavmlvrlpyhlsalsqaaaivalrhsadtlgtveklsvervrvaarleelgyav
vpsesnfvffgdfsdqhaawqafldrgvlirdvgiaghlrttigvpeendafldaaaeii
klnl

Timeline for d3cq6e_:

• d3cq6e_ first appeared in SCOPe 2.03
  
• d3cq6e_ appears in SCOPe 2.06
  
• d3cq6e_ appears in the current release, SCOPe 2.08