Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) |
Family c.67.1.0: automated matches [191328] (1 protein) not a true family |
Protein automated matches [190151] (160 species) not a true protein |
Species Corynebacterium glutamicum [231893] (3 PDB entries) |
Domain d3cq6e_: 3cq6 E: [231900] automated match to d3hdoa_ complexed with po4 |
PDB Entry: 3cq6 (more details), 2.1 Å
SCOPe Domain Sequences for d3cq6e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cq6e_ c.67.1.0 (E:) automated matches {Corynebacterium glutamicum} kitlsdlplreelrgehaygapqlnvdirlntnenpyppsealvadlvatvdkiatelnr yperdavelrdelaayitkqtgvavtrdnlwaangsneilqqllqafggpgrtalgfqps ysmhpilakgthtefiavsrgadfridmdvaleeirakqpdivfvttpnnptgdvtsldd veriinvapgivivdeayaefspspsattllekyptklvvsrtmskafdfaggrlgyfva npafidavmlvrlpyhlsalsqaaaivalrhsadtlgtveklsvervrvaarleelgyav vpsesnfvffgdfsdqhaawqafldrgvlirdvgiaghlrttigvpeendafldaaaeii klnl
Timeline for d3cq6e_: