![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.7: C2 domain-like [49561] (5 superfamilies) sandwich; 8 strands in 2 sheets; greek-key |
![]() | Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (4 families) ![]() two constituent families are related by circular permutation |
![]() | Family b.7.1.1: PLC-like (P variant) [49563] (12 proteins) |
![]() | Protein Domain from protein kinase C delta [49573] (1 species) rudiment form lacking calcium-binding site |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [49574] (1 PDB entry) |
![]() | Domain d1bdya_: 1bdy A: [23190] has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1bdy (more details), 2.2 Å
SCOPe Domain Sequences for d1bdya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bdya_ b.7.1.1 (A:) Domain from protein kinase C delta {Norway rat (Rattus norvegicus) [TaxId: 10116]} mapflrisfnsyelgslqaeddasqpfcavkmkealttdrgktlvqkkptmypewkstfd ahiyegrviqivlmraaedpmsevtvgvsvlaerckknngkaefwldlqpqakvlmcvqy fle
Timeline for d1bdya_: