Lineage for d1bdya_ (1bdy A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2772794Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2772795Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (4 families) (S)
    two constituent families are related by circular permutation
  5. 2772796Family b.7.1.1: PLC-like (P variant) [49563] (12 proteins)
  6. 2772803Protein Domain from protein kinase C delta [49573] (1 species)
    rudiment form lacking calcium-binding site
  7. 2772804Species Norway rat (Rattus norvegicus) [TaxId:10116] [49574] (1 PDB entry)
  8. 2772805Domain d1bdya_: 1bdy A: [23190]
    has additional insertions and/or extensions that are not grouped together

Details for d1bdya_

PDB Entry: 1bdy (more details), 2.2 Å

PDB Description: c2 domain from protein kinase c delta
PDB Compounds: (A:) protein kinase c

SCOPe Domain Sequences for d1bdya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bdya_ b.7.1.1 (A:) Domain from protein kinase C delta {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mapflrisfnsyelgslqaeddasqpfcavkmkealttdrgktlvqkkptmypewkstfd
ahiyegrviqivlmraaedpmsevtvgvsvlaerckknngkaefwldlqpqakvlmcvqy
fle

SCOPe Domain Coordinates for d1bdya_:

Click to download the PDB-style file with coordinates for d1bdya_.
(The format of our PDB-style files is described here.)

Timeline for d1bdya_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1bdyb_