Lineage for d3cq5c_ (3cq5 C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2896671Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2896672Protein automated matches [190151] (166 species)
    not a true protein
  7. 2896989Species Corynebacterium glutamicum [231893] (3 PDB entries)
  8. 2896992Domain d3cq5c_: 3cq5 C: [231898]
    automated match to d3hdoa_
    complexed with 144, pmp, so4

Details for d3cq5c_

PDB Entry: 3cq5 (more details), 1.8 Å

PDB Description: Histidinol-phosphate aminotransferase from Corynebacterium glutamicum in complex with PMP
PDB Compounds: (C:) Histidinol-phosphate aminotransferase

SCOPe Domain Sequences for d3cq5c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cq5c_ c.67.1.0 (C:) automated matches {Corynebacterium glutamicum}
kitlsdlplreelrgehaygapqlnvdirlntnenpyppsealvadlvatvdkiatelnr
yperdavelrdelaayitkqtgvavtrdnlwaangsneilqqllqafggpgrtalgfqps
ysmhpilakgthtefiavsrgadfridmdvaleeirakqpdivfvttpnnptgdvtsldd
veriinvapgivivdeayaefspspsattllekyptklvvsrtmskafdfaggrlgyfva
npafidavmlvrlpyhlsalsqaaaivalrhsadtlgtveklsvervrvaarleelgyav
vpsesnfvffgdfsdqhaawqafldrgvlirdvgiaghlrttigvpeendafldaaaeii
klnl

SCOPe Domain Coordinates for d3cq5c_:

Click to download the PDB-style file with coordinates for d3cq5c_.
(The format of our PDB-style files is described here.)

Timeline for d3cq5c_: