Lineage for d3cq6a_ (3cq6 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2132229Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2132230Protein automated matches [190151] (121 species)
    not a true protein
  7. 2132433Species Corynebacterium glutamicum [231893] (3 PDB entries)
  8. 2132437Domain d3cq6a_: 3cq6 A: [231897]
    automated match to d3hdoa_
    complexed with po4

Details for d3cq6a_

PDB Entry: 3cq6 (more details), 2.1 Å

PDB Description: Histidinol-phosphate aminotransferase from Corynebacterium glutamicum holo-form (PLP covalently bound )
PDB Compounds: (A:) Histidinol-phosphate aminotransferase

SCOPe Domain Sequences for d3cq6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cq6a_ c.67.1.0 (A:) automated matches {Corynebacterium glutamicum}
kitlsdlplreelrgehaygapqlnvdirlntnenpyppsealvadlvatvdkiatelnr
yperdavelrdelaayitkqtgvavtrdnlwaangsneilqqllqafggpgrtalgfqps
ysmhpilakgthtefiavsrgadfridmdvaleeirakqpdivfvttpnnptgdvtsldd
veriinvapgivivdeayaefspspsattllekyptklvvsrtmskafdfaggrlgyfva
npafidavmlvrlpyhlsalsqaaaivalrhsadtlgtveklsvervrvaarleelgyav
vpsesnfvffgdfsdqhaawqafldrgvlirdvgiaghlrttigvpeendafldaaaeii
klnl

SCOPe Domain Coordinates for d3cq6a_:

Click to download the PDB-style file with coordinates for d3cq6a_.
(The format of our PDB-style files is described here.)

Timeline for d3cq6a_: