SCOPe 2.06: Domain d3cq5b_: 3cq5 B:

Lineage for d3cq5b_ (3cq5 B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.0: automated matches [191328] (1 protein)
   not a true family

6. Protein automated matches [190151] (121 species)
   not a true protein

7. Species Corynebacterium glutamicum [231893] (3 PDB entries)

8. Domain d3cq5b_: 3cq5 B: [231895]
   automated match to d3hdoa_
   complexed with 144, pmp, so4

Details for d3cq5b_

PDB Entry: 3cq5, 1.8 Å

PDB Description: Histidinol-phosphate aminotransferase from Corynebacterium glutamicum in complex with PMP

PDB Compounds: (B:) Histidinol-phosphate aminotransferase

SCOPe Domain Sequences for d3cq5b_:

Sequence; same for both SEQRES and ATOM records:

>d3cq5b_ c.67.1.0 (B:) automated matches {Corynebacterium glutamicum}
mtkitlsdlplreelrgehaygapqlnvdirlntnenpyppsealvadlvatvdkiatel
nryperdavelrdelaayitkqtgvavtrdnlwaangsneilqqllqafggpgrtalgfq
psysmhpilakgthtefiavsrgadfridmdvaleeirakqpdivfvttpnnptgdvtsl
ddveriinvapgivivdeayaefspspsattllekyptklvvsrtmskafdfaggrlgyf
vanpafidavmlvrlpyhlsalsqaaaivalrhsadtlgtveklsvervrvaarleelgy
avvpsesnfvffgdfsdqhaawqafldrgvlirdvgiaghlrttigvpeendafldaaae
iiklnl

Timeline for d3cq5b_:

• d3cq5b_ first appeared in SCOPe 2.03
  
• d3cq5b_ appears in SCOPe 2.05
  
• d3cq5b_ appears in SCOPe 2.07
  
• d3cq5b_ appears in the current release, SCOPe 2.08