Lineage for d3cq4b1 (3cq4 B:3-366)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2132229Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2132230Protein automated matches [190151] (121 species)
    not a true protein
  7. 2132433Species Corynebacterium glutamicum [231893] (3 PDB entries)
  8. 2132441Domain d3cq4b1: 3cq4 B:3-366 [231894]
    Other proteins in same PDB: d3cq4a2, d3cq4b2
    automated match to d3hdob_
    complexed with act

Details for d3cq4b1

PDB Entry: 3cq4 (more details), 2.2 Å

PDB Description: Histidinol-phosphate aminotransferase from Corynebacterium glutamicum
PDB Compounds: (B:) Histidinol-phosphate aminotransferase

SCOPe Domain Sequences for d3cq4b1:

Sequence, based on SEQRES records: (download)

>d3cq4b1 c.67.1.0 (B:3-366) automated matches {Corynebacterium glutamicum}
kitlsdlplreelrgehaygapqlnvdirlntnenpyppsealvadlvatvdkiatelnr
yperdavelrdelaayitkqtgvavtrdnlwaangsneilqqllqafggpgrtalgfqps
ysmhpilakgthtefiavsrgadfridmdvaleeirakqpdivfvttpnnptgdvtsldd
veriinvapgivivdeayaefspspsattllekyptklvvsrtmskafdfaggrlgyfva
npafidavmlvrlpyhlsalsqaaaivalrhsadtlgtveklsvervrvaarleelgyav
vpsesnfvffgdfsdqhaawqafldrgvlirdvgiaghlrttigvpeendafldaaaeii
klnl

Sequence, based on observed residues (ATOM records): (download)

>d3cq4b1 c.67.1.0 (B:3-366) automated matches {Corynebacterium glutamicum}
kitlsdlplreelrvdirlntnenpyppsealvadlvatvdkiateldavelrdelaayi
tkqtgvavtrdnlwaangsneilqqllqafggpgrtalgfqpsysmhpilakgthtefia
vsrgadfridmdvaleeirakqpdivfvttpnnptgdvtslddveriinvapgivivdea
yaefspspsattllekyptklvvsrtmskafdfaggrlgyfvanpafidavmlvrlpyhl
salsqaaaivalrhsadtlgtveklsvervrvaarleelgyavvpsesnfvffgdqhaaw
qafldrgvlirdvgiaghlrttigvpeendafldaaaeiilnl

SCOPe Domain Coordinates for d3cq4b1:

Click to download the PDB-style file with coordinates for d3cq4b1.
(The format of our PDB-style files is described here.)

Timeline for d3cq4b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3cq4b2