SCOPe 2.05: Domain d3cpfb2: 3cpf B:84-151

Lineage for d3cpfb2 (3cpf B:84-151)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families)

5. Family b.40.4.0: automated matches [191416] (1 protein)
   not a true family

6. Protein automated matches [190576] (23 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225402] (8 PDB entries)

8. Domain d3cpfb2: 3cpf B:84-151 [231892]
   Other proteins in same PDB: d3cpfa1, d3cpfb1
   automated match to d3hksa2
   complexed with unx

Details for d3cpfb2

PDB Entry: 3cpf, 2.5 Å

PDB Description: crystal structure of human eukaryotic translation initiation factor eif5a

PDB Compounds: (B:) Eukaryotic translation initiation factor 5A-1

SCOPe Domain Sequences for d3cpfb2:

Sequence; same for both SEQRES and ATOM records:

>d3cpfb2 b.40.4.0 (B:84-151) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ikrndfqligiqdgylsllqdsgevredlrlpegdlgkeieqkydcgeeilitvlsamte
eaavaika

Timeline for d3cpfb2:

• d3cpfb2 first appeared in SCOPe 2.03
  
• d3cpfb2 appears in SCOPe 2.04
  
• d3cpfb2 appears in SCOPe 2.06
  
• d3cpfb2 appears in the current release, SCOPe 2.08