Lineage for d3cpfb2 (3cpf B:84-151)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2381452Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2382744Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2383832Family b.40.4.0: automated matches [191416] (1 protein)
    not a true family
  6. 2383833Protein automated matches [190576] (33 species)
    not a true protein
  7. 2383890Species Human (Homo sapiens) [TaxId:9606] [225402] (9 PDB entries)
  8. 2383902Domain d3cpfb2: 3cpf B:84-151 [231892]
    Other proteins in same PDB: d3cpfa1, d3cpfb1
    automated match to d3hksa2
    complexed with unx

Details for d3cpfb2

PDB Entry: 3cpf (more details), 2.5 Å

PDB Description: crystal structure of human eukaryotic translation initiation factor eif5a
PDB Compounds: (B:) Eukaryotic translation initiation factor 5A-1

SCOPe Domain Sequences for d3cpfb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cpfb2 b.40.4.0 (B:84-151) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ikrndfqligiqdgylsllqdsgevredlrlpegdlgkeieqkydcgeeilitvlsamte
eaavaika

SCOPe Domain Coordinates for d3cpfb2:

Click to download the PDB-style file with coordinates for d3cpfb2.
(The format of our PDB-style files is described here.)

Timeline for d3cpfb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3cpfb1