SCOPe 2.08: Domain d3cpfb1: 3cpf B:15-83

Lineage for d3cpfb1 (3cpf B:15-83)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families)
   many known members contain KOW motif

5. Family b.34.5.0: automated matches [227245] (1 protein)
   not a true family

6. Protein automated matches [227015] (11 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [231888] (1 PDB entry)

8. Domain d3cpfb1: 3cpf B:15-83 [231891]
   Other proteins in same PDB: d3cpfa2, d3cpfb2
   automated match to d3hksb1
   complexed with unx

Details for d3cpfb1

PDB Entry: 3cpf, 2.5 Å

PDB Description: crystal structure of human eukaryotic translation initiation factor eif5a

PDB Compounds: (B:) Eukaryotic translation initiation factor 5A-1

SCOPe Domain Sequences for d3cpfb1:

Sequence, based on SEQRES records:

>d3cpfb1 b.34.5.0 (B:15-83) automated matches {Human (Homo sapiens) [TaxId: 9606]}
satfpmqcsalrkngfvvlkgrpckivemstsktgkhghakvhlvgidiftgkkyedicp
sthnmdvpn

Sequence, based on observed residues (ATOM records):

>d3cpfb1 b.34.5.0 (B:15-83) automated matches {Human (Homo sapiens) [TaxId: 9606]}
satfpmqcsalrkngfvvlkgrpckivemsvhlvgidiftgkkyedicpsthnmdvpn

Timeline for d3cpfb1:

• d3cpfb1 first appeared in SCOPe 2.03
  
• d3cpfb1 appears in SCOPe 2.07