Lineage for d1he8a2 (1he8 A:353-524)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 11282Fold b.7: C2 domain-like [49561] (4 superfamilies)
  4. 11283Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (2 families) (S)
  5. 11284Family b.7.1.1: PLC-like (P variant) [49563] (5 proteins)
  6. 11295Protein Phoshoinositide 3-kinase (PI3K) [49570] (2 species)
  7. 11296Species Human (Homo sapiens) [TaxId:9606] [49572] (3 PDB entries)
  8. 11299Domain d1he8a2: 1he8 A:353-524 [23189]
    Other proteins in same PDB: d1he8a1, d1he8a3, d1he8a4, d1he8b_

Details for d1he8a2

PDB Entry: 1he8 (more details), 3 Å

PDB Description: ras g12v - pi 3-kinase gamma complex
PDB Compounds: (A:)

SCOP Domain Sequences for d1he8a2:

Sequence, based on SEQRES records: (download)

>d1he8a2 b.7.1.1 (A:353-524) Phoshoinositide 3-kinase (PI3K) {Human (Homo sapiens)}
slwdcdrkfrvkirgidipvlprntdltvfveaniqhgqqvlcqrrtspkpfteevlwnv
wlefsikikdlpkgallnlqiycgkapalsskasaespsseskgkvrllyyvnlllidhr
fllrrgeyvlhmwqisgkgedqgsfnadkltsatnpdkensmsisilldnyc

Sequence, based on observed residues (ATOM records): (download)

>d1he8a2 b.7.1.1 (A:353-524) Phoshoinositide 3-kinase (PI3K) {Human (Homo sapiens)}
slwdcdrkfrvkirgidipvlpltvfveaniqhgqqvlcqrrtspkpfteevlwnvwlef
sikikdlpkgallnlqiyckvrllyyvnlllidhrfllrrgeyvlhmwqisnadkltsat
npdkensmsisilldnyc

SCOP Domain Coordinates for d1he8a2:

Click to download the PDB-style file with coordinates for d1he8a2.
(The format of our PDB-style files is described here.)

Timeline for d1he8a2: