![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families) ![]() many known members contain KOW motif |
![]() | Family b.34.5.0: automated matches [227245] (1 protein) not a true family |
![]() | Protein automated matches [227015] (11 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [231888] (1 PDB entry) |
![]() | Domain d3cpfa1: 3cpf A:15-83 [231889] Other proteins in same PDB: d3cpfa2, d3cpfb2 automated match to d3hksb1 complexed with unx |
PDB Entry: 3cpf (more details), 2.5 Å
SCOPe Domain Sequences for d3cpfa1:
Sequence, based on SEQRES records: (download)
>d3cpfa1 b.34.5.0 (A:15-83) automated matches {Human (Homo sapiens) [TaxId: 9606]} satfpmqcsalrkngfvvlkgrpckivemstsktgkhghakvhlvgidiftgkkyedicp sthnmdvpn
>d3cpfa1 b.34.5.0 (A:15-83) automated matches {Human (Homo sapiens) [TaxId: 9606]} satfpmqcsalrkngfvvlkgrpckivemstskthakvhlvgidiftgkkyedicpsthn mdvpn
Timeline for d3cpfa1: