Lineage for d3c8ba_ (3c8b A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963580Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2963581Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) (S)
  5. 2964005Family d.92.1.7: Clostridium neurotoxins, catalytic domain [55512] (2 proteins)
  6. 2964072Protein automated matches [190410] (2 species)
    not a true protein
  7. 2964073Species Clostridium botulinum [TaxId:1491] [187385] (26 PDB entries)
  8. 2964075Domain d3c8ba_: 3c8b A: [231883]
    automated match to d3bwia_
    complexed with so4, zn

Details for d3c8ba_

PDB Entry: 3c8b (more details), 1.47 Å

PDB Description: Crystal structure of the catalytic domain of botulinum neurotoxin serotype A with inhibitory peptide RRGI
PDB Compounds: (A:) Botulinum neurotoxin A light chain

SCOPe Domain Sequences for d3c8ba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c8ba_ d.92.1.7 (A:) automated matches {Clostridium botulinum [TaxId: 1491]}
mpfvnkqfnykdpvngvdiayikipnagqmqpvkafkihnkiwviperdtftnpeegdln
pppeakqvpvsyydstylstdnekdnylkgvtklferiystdlgrmlltsivrgipfwgg
stidtelkvidtncinviqpdgsyrseelnlviigpsadiiqfecksfghevlnltrngy
gstqyirfspdftfgfeeslevdtnpllgagkfatdpavtlahelihaghrlygiainpn
rvfkvntnayyemsglevsfeelrtfgghdakfidslqenefrlyyynkfkdiastlnka
ksivgttaslqymknvfkekyllsedtsgkfsvdklkfdklykmlteiytednfvkffkv
lnrktylnfdkavfkinivpkvnytiydgfnlrntnlaanfngqnteinnmnftklknft
glf

SCOPe Domain Coordinates for d3c8ba_:

Click to download the PDB-style file with coordinates for d3c8ba_.
(The format of our PDB-style files is described here.)

Timeline for d3c8ba_: