Lineage for d1e8za2 (1e8z A:357-522)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 554333Fold b.7: C2 domain-like [49561] (4 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 554334Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (2 families) (S)
    two constituent families are related by circular permutation
  5. 554335Family b.7.1.1: PLC-like (P variant) [49563] (6 proteins)
  6. 554349Protein Phoshoinositide 3-kinase (PI3K) [49570] (2 species)
  7. 554350Species Human (Homo sapiens) [TaxId:9606] [49572] (3 PDB entries)
  8. 554352Domain d1e8za2: 1e8z A:357-522 [23188]
    Other proteins in same PDB: d1e8za1, d1e8za3, d1e8za4
    complexed with stu; mutant

Details for d1e8za2

PDB Entry: 1e8z (more details), 2.4 Å

PDB Description: structure determinants of phosphoinositide 3-kinase inhibition by wortmannin, ly294002, quercetin, myricetin and staurosporine
PDB Compounds: (A:)

SCOP Domain Sequences for d1e8za2:

Sequence, based on SEQRES records: (download)

>d1e8za2 b.7.1.1 (A:357-522) Phoshoinositide 3-kinase (PI3K) {Human (Homo sapiens)}
cdrkfrvkirgidipvlprntdltvfveaniqhgqqvlcqrrtspkpfteevlwnvwlef
sikikdlpkgallnlqiycgkapalsskasaespsseskgkvrllyyvnlllidhrfllr
rgeyvlhmwqisgkgedqgsfnadkltsatnpdkensmsisilldn

Sequence, based on observed residues (ATOM records): (download)

>d1e8za2 b.7.1.1 (A:357-522) Phoshoinositide 3-kinase (PI3K) {Human (Homo sapiens)}
cdrkfrvkirgidipvlprntdltvfveaniqhgqqvlcqrrtspkpfteevlwnvwlef
sikikdlpkgallnlqiycllyyvnlllidhrfllrrgeyvlhmwqisgfnadkltsatn
pdkensmsisilldn

SCOP Domain Coordinates for d1e8za2:

Click to download the PDB-style file with coordinates for d1e8za2.
(The format of our PDB-style files is described here.)

Timeline for d1e8za2: