![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (27 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
![]() | Protein automated matches [190226] (81 species) not a true protein |
![]() | Species Dengue virus 2 thailand/16681/84 [TaxId:31634] [231877] (2 PDB entries) |
![]() | Domain d3c5xa2: 3c5x A:298-394 [231878] Other proteins in same PDB: d3c5xa1, d3c5xa3 automated match to d1ok8a1 protein/RNA complex |
PDB Entry: 3c5x (more details), 2.2 Å
SCOPe Domain Sequences for d3c5xa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3c5xa2 b.1.18.0 (A:298-394) automated matches {Dengue virus 2 thailand/16681/84 [TaxId: 31634]} sysmctgkfkvvkeiaetqhgtivirvqyegdgspckipfeimdlekrhvlgrlitvnpi vtekdspvnieaeppfgdsyiiigvepgqlklnwfkk
Timeline for d3c5xa2: