Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) |
Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins) |
Protein Staphylococcal enterotoxin C3, SEC3 [54344] (1 species) |
Species Staphylococcus aureus [TaxId:1280] [54345] (20 PDB entries) Uniprot P23313 |
Domain d3byyb2: 3byy B:117-235 [231873] Other proteins in same PDB: d3byya_, d3byyb1 automated match to d1se4a2 complexed with so4 |
PDB Entry: 3byy (more details), 2.2 Å
SCOPe Domain Sequences for d3byyb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3byyb2 d.15.6.1 (B:117-235) Staphylococcal enterotoxin C3, SEC3 {Staphylococcus aureus [TaxId: 1280]} egnhfdngnlqnvlvrvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefns spyetgyikfienngntfwydmmpapgdkfdqskylmmyndnktvdsksvkievhlttk
Timeline for d3byyb2: