Lineage for d3bzdb1 (3bzd B:2-116)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2788203Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 2788945Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 proteins)
  6. 2789011Protein Staphylococcal enterotoxin C3, SEC3 [50228] (1 species)
  7. 2789012Species Staphylococcus aureus [TaxId:1280] [50229] (20 PDB entries)
    Uniprot P23313
  8. 2789036Domain d3bzdb1: 3bzd B:2-116 [231872]
    Other proteins in same PDB: d3bzda_, d3bzdb2
    automated match to d3seba1
    complexed with so4

Details for d3bzdb1

PDB Entry: 3bzd (more details), 2.3 Å

PDB Description: Manipulating the coupled folding and binding process drives affinity maturation in a protein-protein complex
PDB Compounds: (B:) Enterotoxin type C-3

SCOPe Domain Sequences for d3bzdb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bzdb1 b.40.2.2 (B:2-116) Staphylococcal enterotoxin C3, SEC3 {Staphylococcus aureus [TaxId: 1280]}
sqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdkflahdliynisdkklkny
dkvktellnedlakkykdevvdvygsnyyvncyfsskdnvwwhgktcmyggitkh

SCOPe Domain Coordinates for d3bzdb1:

Click to download the PDB-style file with coordinates for d3bzdb1.
(The format of our PDB-style files is described here.)

Timeline for d3bzdb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3bzdb2
View in 3D
Domains from other chains:
(mouse over for more information)
d3bzda_