SCOPe 2.03: Domain d3byyb1: 3byy B:2-116

Lineage for d3byyb1 (3byy B:2-116)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families)

5. Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 proteins)

6. Protein automated matches [226992] (1 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [225594] (7 PDB entries)

8. Domain d3byyb1: 3byy B:2-116 [231871]
   Other proteins in same PDB: d3byya_, d3byyb2
   automated match to d3seba1
   complexed with so4

Details for d3byyb1

PDB Entry: 3byy, 2.2 Å

PDB Description: Manipulating the coupled folding and binding process drives affinity maturation in a protein-protein complex

PDB Compounds: (B:) Enterotoxin type C-3

SCOPe Domain Sequences for d3byyb1:

Sequence; same for both SEQRES and ATOM records:

>d3byyb1 b.40.2.2 (B:2-116) automated matches {Staphylococcus aureus [TaxId: 1280]}
sqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdkflahdliynisdkklkny
dkvktellnedlakkykdevvdvygsnyyvncyfsskdnvwwpgktcmyggitkh

Timeline for d3byyb1:

• d3byyb1 is new in SCOPe 2.03-stable
  
• d3byyb1 appears in SCOPe 2.04
  
• d3byyb1 appears in the current release, SCOPe 2.08