Lineage for d3bwqb_ (3bwq B:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1563153Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 1564135Superfamily b.121.6: Group I dsDNA viruses [88648] (2 families) (S)
  5. 1564335Family b.121.6.0: automated matches [227135] (1 protein)
    not a true family
  6. 1564336Protein automated matches [226836] (6 species)
    not a true protein
  7. 1564390Species Simian virus 40 [TaxId:10633] [225418] (2 PDB entries)
  8. 1564397Domain d3bwqb_: 3bwq B: [231864]
    automated match to d3bwqd_

Details for d3bwqb_

PDB Entry: 3bwq (more details), 2.3 Å

PDB Description: structure of free sv40 vp1 pentamer
PDB Compounds: (B:) Capsid protein VP1

SCOPe Domain Sequences for d3bwqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bwqb_ b.121.6.0 (B:) automated matches {Simian virus 40 [TaxId: 10633]}
sftevecflnpqmgnpdehqkglskslaaekqftddspdkeqlpcysvariplpninedl
tcgnilmweavtvktevigvtamlnlhsgtqkthengagkpiqgsnfhffavggeplelq
gvlanyrtkypaqtvtpknatvdsqqmntdhkavldkdnaypvecwvpdpsknentryfg
tytggenvppvlhitntattvlldeqgvgplckadslyvsavdicglftntsgtqqwkgl
pryfkitlrkrsvkn

SCOPe Domain Coordinates for d3bwqb_:

Click to download the PDB-style file with coordinates for d3bwqb_.
(The format of our PDB-style files is described here.)

Timeline for d3bwqb_: