Lineage for d3bo5a_ (3bo5 A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2072411Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2073020Superfamily b.85.7: SET domain [82199] (4 families) (S)
    duplication: the core is composed of two structural repeats similar to (circularly permuted) repeats of AFPIII
    also contains a substrate-binding alpha+beta subdomain inserted in the core
  5. 2073097Family b.85.7.0: automated matches [227191] (1 protein)
    not a true family
  6. 2073098Protein automated matches [226914] (2 species)
    not a true protein
  7. 2073099Species Human (Homo sapiens) [TaxId:9606] [225158] (21 PDB entries)
  8. 2073100Domain d3bo5a_: 3bo5 A: [231860]
    automated match to d3mo5c_
    complexed with gol, sah, zn

Details for d3bo5a_

PDB Entry: 3bo5 (more details), 1.59 Å

PDB Description: Crystal structure of methyltransferase domain of human Histone-lysine N-methyltransferase SETMAR
PDB Compounds: (A:) Histone-lysine N-methyltransferase SETMAR

SCOPe Domain Sequences for d3bo5a_:

Sequence, based on SEQRES records: (download)

>d3bo5a_ b.85.7.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
teqldvacgqenlpvgawppgaapapfqytpdhvvgpgadidptqitfpgcicvktpclp
gtcsclrhgenyddnsclrdigsggkyaepvfecnvlcrcsdhcrnrvvqkglqfhfqvf
kthkkgwglrtlefipkgrfvceyagevlgfsevqrrihlqtksdsnyiiairehvyngq
vmetfvdptyignigrflnhscepnllmipvridsmvpklalfaakdivpeeelsydysg
rylnltvsaskerldhgklrkpcycgaksctaflpfdss

Sequence, based on observed residues (ATOM records): (download)

>d3bo5a_ b.85.7.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
teqldvacgqenlpvgawppgaapapfqytpdhvvgpgadidptqitfpgcicvktpclp
gtcsclrhgenyddnsclrdkyaepvfecnvlcrcsdhcrnrvvqkglqfhfqvfkthkk
gwglrtlefipkgrfvceyagevlgfsevqrrihlqtksdsnyiiairehvmetfvdpty
ignigrflnhscepnllmipvridsmvpklalfaakdivpeeelsydysgrylnltvsas
kerldhgklrkpcycgaksctaflpfdss

SCOPe Domain Coordinates for d3bo5a_:

Click to download the PDB-style file with coordinates for d3bo5a_.
(The format of our PDB-style files is described here.)

Timeline for d3bo5a_: