Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) |
Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
Protein automated matches [226922] (55 species) not a true protein |
Species Polaromonas sp. [TaxId:296591] [231854] (1 PDB entry) |
Domain d3bjsb1: 3bjs B:37-165 [231858] Other proteins in same PDB: d3bjsa2, d3bjsb2 automated match to d2o56a1 complexed with mg |
PDB Entry: 3bjs (more details), 2.7 Å
SCOPe Domain Sequences for d3bjsb1:
Sequence, based on SEQRES records: (download)
>d3bjsb1 d.54.1.0 (B:37-165) automated matches {Polaromonas sp. [TaxId: 296591]} mkitkinaiplsyrlpegktvtmgvgstikrdaiiirvetsegitgygeahpgrspgait slihntiapmligmkatdcvgawqrvhrmqlsshglgagaalaisgidmalwdirgkaan mplyellgg
>d3bjsb1 d.54.1.0 (B:37-165) automated matches {Polaromonas sp. [TaxId: 296591]} mkitkinaiplsyrlptvtmgvgstikrdaiiirvetsegitgygeahpgrspgaitsli hntiapmligmkatdcvgawqrvhrmqlsshglgagaalaisgidmalwdirgkaanmpl yellgg
Timeline for d3bjsb1: