SCOPe 2.08: Domain d3bjsb1: 3bjs B:37-165

Lineage for d3bjsb1 (3bjs B:37-165)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (95 species)
   not a true protein

7. Species Polaromonas sp. [TaxId:296591] [231854] (1 PDB entry)

8. Domain d3bjsb1: 3bjs B:37-165 [231858]
   Other proteins in same PDB: d3bjsa2, d3bjsb2
   automated match to d2o56a1
   complexed with mg

Details for d3bjsb1

PDB Entry: 3bjs, 2.7 Å

PDB Description: crystal structure of a member of enolase superfamily from polaromonas sp. js666

PDB Compounds: (B:) Mandelate racemase/muconate lactonizing enzyme

SCOPe Domain Sequences for d3bjsb1:

Sequence, based on SEQRES records:

>d3bjsb1 d.54.1.0 (B:37-165) automated matches {Polaromonas sp. [TaxId: 296591]}
mkitkinaiplsyrlpegktvtmgvgstikrdaiiirvetsegitgygeahpgrspgait
slihntiapmligmkatdcvgawqrvhrmqlsshglgagaalaisgidmalwdirgkaan
mplyellgg

Sequence, based on observed residues (ATOM records):

>d3bjsb1 d.54.1.0 (B:37-165) automated matches {Polaromonas sp. [TaxId: 296591]}
mkitkinaiplsyrlptvtmgvgstikrdaiiirvetsegitgygeahpgrspgaitsli
hntiapmligmkatdcvgawqrvhrmqlsshglgagaalaisgidmalwdirgkaanmpl
yellgg

Timeline for d3bjsb1:

• d3bjsb1 first appeared in SCOPe 2.03
  
• d3bjsb1 appears in SCOPe 2.07