SCOPe 2.04: Domain d3bjsa2: 3bjs A:166-410

Lineage for d3bjsa2 (3bjs A:166-410)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.0: automated matches [227196] (1 protein)
   not a true family

6. Protein automated matches [226923] (59 species)
   not a true protein

7. Species Polaromonas sp. [TaxId:296591] [231856] (1 PDB entry)

8. Domain d3bjsa2: 3bjs A:166-410 [231857]
   Other proteins in same PDB: d3bjsa1, d3bjsb1
   automated match to d2o56a2
   complexed with mg

Details for d3bjsa2

PDB Entry: 3bjs, 2.7 Å

PDB Description: crystal structure of a member of enolase superfamily from polaromonas sp. js666

PDB Compounds: (A:) Mandelate racemase/muconate lactonizing enzyme

SCOPe Domain Sequences for d3bjsa2:

Sequence, based on SEQRES records:

>d3bjsa2 c.1.11.0 (A:166-410) automated matches {Polaromonas sp. [TaxId: 296591]}
skrripayaggialgyqpkeslaeeaqeyiargykalklrigdaarvdiervrhvrkvlg
devdiltdantaytmadarrvlpvlaeiqagwleepfacndfasyrevakitplvpiaag
enhytrfefgqmldagavqvwqpdlskcggitegiriaamasayripinahssatglnha
atihflaatenagyfeacvskfnpfrdmfgtsfeigadgcveppdapglgievdesifek
ypavd

Sequence, based on observed residues (ATOM records):

>d3bjsa2 c.1.11.0 (A:166-410) automated matches {Polaromonas sp. [TaxId: 296591]}
skrripayaggialgyqpkeslaeeaqeyiargykalklrigdaarvdiervrhvrkvlg
devdiltdantaytmadarrvlpvlaeiqagwleepfacndfasyrevakitplvpiaag
enhytrfefgqmldagavqvwqpdlskcggitegiriaamasayripinahssatglnha
atihflaatenagyfeacvskfnpfrdmfgtfeigadgcveppdapglgievdesifeky
pavd

Timeline for d3bjsa2:

• d3bjsa2 first appeared in SCOPe 2.03
  
• d3bjsa2 appears in SCOPe 2.05
  
• d3bjsa2 appears in the current release, SCOPe 2.08