Lineage for d3bjsa2 (3bjs A:166-410)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2086988Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2087392Family c.1.11.0: automated matches [227196] (1 protein)
    not a true family
  6. 2087393Protein automated matches [226923] (73 species)
    not a true protein
  7. 2087812Species Polaromonas sp. [TaxId:296591] [231856] (1 PDB entry)
  8. 2087813Domain d3bjsa2: 3bjs A:166-410 [231857]
    Other proteins in same PDB: d3bjsa1, d3bjsb1
    automated match to d2o56a2
    complexed with mg

Details for d3bjsa2

PDB Entry: 3bjs (more details), 2.7 Å

PDB Description: crystal structure of a member of enolase superfamily from polaromonas sp. js666
PDB Compounds: (A:) Mandelate racemase/muconate lactonizing enzyme

SCOPe Domain Sequences for d3bjsa2:

Sequence, based on SEQRES records: (download)

>d3bjsa2 c.1.11.0 (A:166-410) automated matches {Polaromonas sp. [TaxId: 296591]}
skrripayaggialgyqpkeslaeeaqeyiargykalklrigdaarvdiervrhvrkvlg
devdiltdantaytmadarrvlpvlaeiqagwleepfacndfasyrevakitplvpiaag
enhytrfefgqmldagavqvwqpdlskcggitegiriaamasayripinahssatglnha
atihflaatenagyfeacvskfnpfrdmfgtsfeigadgcveppdapglgievdesifek
ypavd

Sequence, based on observed residues (ATOM records): (download)

>d3bjsa2 c.1.11.0 (A:166-410) automated matches {Polaromonas sp. [TaxId: 296591]}
skrripayaggialgyqpkeslaeeaqeyiargykalklrigdaarvdiervrhvrkvlg
devdiltdantaytmadarrvlpvlaeiqagwleepfacndfasyrevakitplvpiaag
enhytrfefgqmldagavqvwqpdlskcggitegiriaamasayripinahssatglnha
atihflaatenagyfeacvskfnpfrdmfgtfeigadgcveppdapglgievdesifeky
pavd

SCOPe Domain Coordinates for d3bjsa2:

Click to download the PDB-style file with coordinates for d3bjsa2.
(The format of our PDB-style files is described here.)

Timeline for d3bjsa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3bjsa1