SCOPe 2.03: Domain d3bibx_: 3bib X:

Lineage for d3bibx_ (3bib X:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (23 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (246 PDB entries)

8. Domain d3bibx_: 3bib X: [231851]
   automated match to d2oypa_
   complexed with na, psf

Details for d3bibx_

PDB Entry: 3bib, 2.5 Å

PDB Description: Tim-4 in complex with phosphatidylserine

PDB Compounds: (X:) T-cell immunoglobulin and mucin domain-containing protein 4

SCOPe Domain Sequences for d3bibx_:

Sequence; same for both SEQRES and ATOM records:

>d3bibx_ b.1.1.0 (X:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dtiigflgqpvtlpchylswsqsrnsmcwgkgscpnskcnaellrtdgtriisrkstkyt
llgkvqfgevsltisntnrgdsgvyccrievpgwfndvkknvrlelrra

Timeline for d3bibx_:

• d3bibx_ is new in SCOPe 2.03-stable
  
• d3bibx_ appears in SCOPe 2.04
  
• d3bibx_ appears in the current release, SCOPe 2.08