Lineage for d1e90a2 (1e90 A:357-521)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2038038Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2038039Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families) (S)
    two constituent families are related by circular permutation
  5. 2038040Family b.7.1.1: PLC-like (P variant) [49563] (12 protein domains)
  6. 2038063Protein Phoshoinositide 3-kinase (PI3K) [49570] (2 species)
  7. 2038122Species Pig (Sus scrofa) [TaxId:9823] [49571] (6 PDB entries)
  8. 2038127Domain d1e90a2: 1e90 A:357-521 [23185]
    Other proteins in same PDB: d1e90a1, d1e90a3, d1e90a4, d1e90a5
    complexed with myc

Details for d1e90a2

PDB Entry: 1e90 (more details), 2.7 Å

PDB Description: structure determinants of phosphoinositide 3-kinase inhibition by wortmannin, ly294002, quercetin, myricetin and staurosporine
PDB Compounds: (A:) phosphatidylinositol 3-kinase catalytic subunit

SCOPe Domain Sequences for d1e90a2:

Sequence, based on SEQRES records: (download)

>d1e90a2 b.7.1.1 (A:357-521) Phoshoinositide 3-kinase (PI3K) {Pig (Sus scrofa) [TaxId: 9823]}
cdrkfrvkirgidipvlprtadltvfveaniqygqqvlcqrrtspkpfteevlwnvwlef
sikikdlpkgallnlqiycgkapalsgktsaempspeskgkaqllyyvnlllidhrfllr
hgeyvlhmwqlsgkgedqgsfnadkltsatnpdkensmsisilld

Sequence, based on observed residues (ATOM records): (download)

>d1e90a2 b.7.1.1 (A:357-521) Phoshoinositide 3-kinase (PI3K) {Pig (Sus scrofa) [TaxId: 9823]}
cdrkfrvkirgidipvlprtadltvfveaniqygqqvlcqrrtspkpfteevlwnvwlef
sikikdlpkgallnlqiycqllyyvnlllidhrfllrhgeyvlhmwqlsfnadkltsatn
pdkensmsisilld

SCOPe Domain Coordinates for d1e90a2:

Click to download the PDB-style file with coordinates for d1e90a2.
(The format of our PDB-style files is described here.)

Timeline for d1e90a2: