Lineage for d3bdbf_ (3bdb F:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1295808Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1295809Protein automated matches [190740] (23 species)
    not a true protein
  7. 1296743Species Ictalurus punctatus [TaxId:7998] [225469] (6 PDB entries)
  8. 1296769Domain d3bdbf_: 3bdb F: [231844]
    automated match to d2qqqb_

Details for d3bdbf_

PDB Entry: 3bdb (more details), 2.8 Å

PDB Description: crystal structure of novel immune-type receptor 11 extracellular fragment from ictalurus punctatus including stalk region
PDB Compounds: (F:) Novel immune-type receptor 11

SCOPe Domain Sequences for d3bdbf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bdbf_ b.1.1.0 (F:) automated matches {Ictalurus punctatus [TaxId: 7998]}
ikelhvktvkrgenvtmecsmskvtnknnlawyrqsfgkvpqyfvryyssnsgykfaegf
kdsrfsmtvndqkfdlniigareddggeyfcgevegiiikftsgtrlqfegsnegskssd
gegssc

SCOPe Domain Coordinates for d3bdbf_:

Click to download the PDB-style file with coordinates for d3bdbf_.
(The format of our PDB-style files is described here.)

Timeline for d3bdbf_: