Lineage for d3bdbe_ (3bdb E:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759376Species Ictalurus punctatus [TaxId:7998] [225469] (6 PDB entries)
  8. 2759401Domain d3bdbe_: 3bdb E: [231843]
    automated match to d2qqqb_

Details for d3bdbe_

PDB Entry: 3bdb (more details), 2.8 Å

PDB Description: crystal structure of novel immune-type receptor 11 extracellular fragment from ictalurus punctatus including stalk region
PDB Compounds: (E:) Novel immune-type receptor 11

SCOPe Domain Sequences for d3bdbe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bdbe_ b.1.1.0 (E:) automated matches {Ictalurus punctatus [TaxId: 7998]}
ikelhvktvkrgenvtmecsmskvtnknnlawyrqsfgkvpqyfvryyssnsgykfaegf
kdsrfsmtvndqkfdlniigareddggeyfcgevegiiikftsgtrlqfegsnegskssd
gegssc

SCOPe Domain Coordinates for d3bdbe_:

Click to download the PDB-style file with coordinates for d3bdbe_.
(The format of our PDB-style files is described here.)

Timeline for d3bdbe_: