Lineage for d1e7va2 (1e7v A:354-524)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 11282Fold b.7: C2 domain-like [49561] (4 superfamilies)
  4. 11283Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (2 families) (S)
  5. 11284Family b.7.1.1: PLC-like (P variant) [49563] (5 proteins)
  6. 11295Protein Phoshoinositide 3-kinase (PI3K) [49570] (2 species)
  7. 11300Species Pig (Sus scrofa) [TaxId:9823] [49571] (5 PDB entries)
  8. 11303Domain d1e7va2: 1e7v A:354-524 [23184]
    Other proteins in same PDB: d1e7va1, d1e7va3, d1e7va4

Details for d1e7va2

PDB Entry: 1e7v (more details), 2.4 Å

PDB Description: structure determinants of phosphoinositide 3-kinase inhibition by wortmannin, ly294002, quercetin, myricetin and staurosporine
PDB Compounds: (A:)

SCOP Domain Sequences for d1e7va2:

Sequence, based on SEQRES records: (download)

>d1e7va2 b.7.1.1 (A:354-524) Phoshoinositide 3-kinase (PI3K) {Pig (Sus scrofa)}
lwdcdrkfrvkirgidipvlprtadltvfveaniqygqqvlcqrrtspkpfteevlwnvw
lefsikikdlpkgallnlqiycgkapalsgktsaempspeskgkaqllyyvnlllidhrf
llrhgeyvlhmwqlsgkgedqgsfnadkltsatnpdkensmsisilldnyc

Sequence, based on observed residues (ATOM records): (download)

>d1e7va2 b.7.1.1 (A:354-524) Phoshoinositide 3-kinase (PI3K) {Pig (Sus scrofa)}
lwdcdrkfrvkirgidipvlprtadltvfveaniqygqqvlcqrrtspkpfteevlwnvw
lefsikikdlpkgallnlqiycqllyyvnlllidhrfllrhgeyvlhmwqlsfnadklts
atnpdkensmsisilldnyc

SCOP Domain Coordinates for d1e7va2:

Click to download the PDB-style file with coordinates for d1e7va2.
(The format of our PDB-style files is described here.)

Timeline for d1e7va2: