Lineage for d3b6ya2 (3b6y A:103-191)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2791336Superfamily b.40.16: HIN-2000 domain-like [159141] (2 families) (S)
    duplication: tandem repeat of two OB-fold domains
  5. 2791337Family b.40.16.1: HIN-200/IF120x domain [159142] (1 protein)
    Pfam PF02760
  6. 2791338Protein Gamma-interferon-inducible protein Ifi-16 [159143] (1 species)
  7. 2791339Species Human (Homo sapiens) [TaxId:9606] [159144] (6 PDB entries)
    Uniprot Q16666 199-301! Uniprot Q16666 302-389
  8. 2791361Domain d3b6ya2: 3b6y A:103-191 [231830]
    automated match to d2oq0a1
    complexed with so4

Details for d3b6ya2

PDB Entry: 3b6y (more details), 2.35 Å

PDB Description: crystal structure of the second hin-200 domain of interferon-inducible protein 16
PDB Compounds: (A:) Gamma-interferon-inducible protein Ifi-16

SCOPe Domain Sequences for d3b6ya2:

Sequence, based on SEQRES records: (download)

>d3b6ya2 b.40.16.1 (A:103-191) Gamma-interferon-inducible protein Ifi-16 {Human (Homo sapiens) [TaxId: 9606]}
pkinqlcsqtkgsfvngvfevhkknvrgeftyyeiqdntgkmevvvhgrlttinceegdk
lkltcfelapksgntgelrsvihshikvi

Sequence, based on observed residues (ATOM records): (download)

>d3b6ya2 b.40.16.1 (A:103-191) Gamma-interferon-inducible protein Ifi-16 {Human (Homo sapiens) [TaxId: 9606]}
pkinqlcsqtkgsfvngvfevhkknvrgeftyyeiqdntgkmevvvhgrlttinceegdk
lkltcfelapksgtgelrsvihshikvi

SCOPe Domain Coordinates for d3b6ya2:

Click to download the PDB-style file with coordinates for d3b6ya2.
(The format of our PDB-style files is described here.)

Timeline for d3b6ya2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3b6ya1