Lineage for d3b6ha1 (3b6h A:23-500)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (63 species)
    not a true protein
  7. 2005573Species Human (Homo sapiens) [TaxId:9606] [196470] (36 PDB entries)
  8. 2005578Domain d3b6ha1: 3b6h A:23-500 [231827]
    Other proteins in same PDB: d3b6ha2, d3b6hb2
    automated match to d3b98a_
    complexed with bog, hem, mxd

Details for d3b6ha1

PDB Entry: 3b6h (more details), 1.62 Å

PDB Description: Crystal structure of human prostacyclin synthase in complex with inhibitor minoxidil
PDB Compounds: (A:) Prostacyclin synthase

SCOPe Domain Sequences for d3b6ha1:

Sequence, based on SEQRES records: (download)

>d3b6ha1 a.104.1.0 (A:23-500) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtrrpgeppldlgsipwlgyaldfgkdaasfltrmkekhgdiftilvggryvtvlldphs
ydavvweprtrldfhayaiflmerifdvqlphyspsdekarmkltllhrelqalteamyt
nlhavllgdateagsgwhemglldfsysfllragyltlygiealprthesqaqdrvhsad
vfhtfrqldrllpklargslsvgdkdhmcsvksrlwkllsparlarrahrskwlesyllh
leemgvseemqaralvlqlwatqgnmgpaafwlllfllknpealaavrgelesilwqaeq
pvsqtttlpqkvldstpvldsvlseslrltaapfitrevvvdlampmadgrefnlrrgdr
lllfpflspqrdpeiytdpevfkynrflnpdgsekkdfykdgkrlknynmpwgaghnhcl
grsyavnsikqfvflvlvhldlelinadveipefdlsrygfglmqpehdvpvryrirp

Sequence, based on observed residues (ATOM records): (download)

>d3b6ha1 a.104.1.0 (A:23-500) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtrrpgeppldlgsipwlgyaldfgkdaasfltrmkekhgdiftilvggryvtvlldphs
ydavvweprtrldfhayaiflmerifdvqlphyspsdekarmkltllhrelqalteamyt
nlhavllgdateagsgwhemglldfsysfllragyltlygiealprthesqaqdrvhsad
vfhtfrqldrllpklargslsvgdkdhmcsvksrlwkllsparlarrahrskwlesyllh
leemgvseemqaralvlqlwatqgnmgpaafwlllfllknpealaavrgelesilwqlpq
kvldstpvldsvlseslrltaapfitrevvvdlampmadgrefnlrrgdrlllfpflspq
rdpeiytdpevfkynrflnpdgsekkdfykdgkrlknynmpwgaghnhclgrsyavnsik
qfvflvlvhldlelinadveipefdlsrygfglmqpehdvpvryrirp

SCOPe Domain Coordinates for d3b6ha1:

Click to download the PDB-style file with coordinates for d3b6ha1.
(The format of our PDB-style files is described here.)

Timeline for d3b6ha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3b6ha2