Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.72: Ribokinase-like [53612] (3 superfamilies) core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest potential superfamily: members of this fold have similar functions but different ATP-binding sites |
Superfamily c.72.1: Ribokinase-like [53613] (6 families) has extra strand located between strands 2 and 3 |
Family c.72.1.0: automated matches [191321] (1 protein) not a true family |
Protein automated matches [190117] (34 species) not a true protein |
Species Burkholderia thailandensis [TaxId:271848] [196112] (5 PDB entries) |
Domain d3b1oa_: 3b1o A: [231817] automated match to d3b1rb_ |
PDB Entry: 3b1o (more details), 2.1 Å
SCOPe Domain Sequences for d3b1oa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3b1oa_ c.72.1.0 (A:) automated matches {Burkholderia thailandensis [TaxId: 271848]} atlicgsiaydnimtfegrfrehilpdqvhlinlsflvptmrrefggcagniayalnllg gdarmmgtlgavdaqpyldrmdalglsreyvrvlpdtysaqamittdldnnqitafhpga mmqshvnhageakdiklaivgpdgfqgmvqhteelaqagvpfifdpgqglplfdgatlrr sielatyiavndyeaklvcdktgwsedeiasrvqaliitrgehgatirhrdgteqipavr aervidptgcgdafrggllygiehgfdwatagrlaslmgalkiahqgpqtyaptraeida rfetafgyrpkgs
Timeline for d3b1oa_: