Lineage for d3b1oa_ (3b1o A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1385058Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 1385059Superfamily c.72.1: Ribokinase-like [53613] (6 families) (S)
    has extra strand located between strands 2 and 3
  5. 1385284Family c.72.1.0: automated matches [191321] (1 protein)
    not a true family
  6. 1385285Protein automated matches [190117] (34 species)
    not a true protein
  7. 1385307Species Burkholderia thailandensis [TaxId:271848] [196112] (5 PDB entries)
  8. 1385323Domain d3b1oa_: 3b1o A: [231817]
    automated match to d3b1rb_

Details for d3b1oa_

PDB Entry: 3b1o (more details), 2.1 Å

PDB Description: Structure of Burkholderia thailandensis nucleoside kinase (BthNK) in ligand-free form
PDB Compounds: (A:) Ribokinase, putative

SCOPe Domain Sequences for d3b1oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b1oa_ c.72.1.0 (A:) automated matches {Burkholderia thailandensis [TaxId: 271848]}
atlicgsiaydnimtfegrfrehilpdqvhlinlsflvptmrrefggcagniayalnllg
gdarmmgtlgavdaqpyldrmdalglsreyvrvlpdtysaqamittdldnnqitafhpga
mmqshvnhageakdiklaivgpdgfqgmvqhteelaqagvpfifdpgqglplfdgatlrr
sielatyiavndyeaklvcdktgwsedeiasrvqaliitrgehgatirhrdgteqipavr
aervidptgcgdafrggllygiehgfdwatagrlaslmgalkiahqgpqtyaptraeida
rfetafgyrpkgs

SCOPe Domain Coordinates for d3b1oa_:

Click to download the PDB-style file with coordinates for d3b1oa_.
(The format of our PDB-style files is described here.)

Timeline for d3b1oa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3b1ob_