![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein CD1, alpha-3 domain [88615] (5 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [88616] (12 PDB entries) |
![]() | Domain d3arba2: 3arb A:186-279 [231814] Other proteins in same PDB: d3arba1, d3arba3, d3arbb_, d3arbc1, d3arbc2, d3arbd1, d3arbd2 automated match to d3area2 complexed with d12, fee, nag, peg |
PDB Entry: 3arb (more details), 2.7 Å
SCOPe Domain Sequences for d3arba2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3arba2 b.1.1.2 (A:186-279) CD1, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]} qekpvawlssvpssahghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetw ylqatldveageeaglacrvkhsslggqdiilyw
Timeline for d3arba2: