SCOPe 2.03: Domain d3axaa_: 3axa A:

Lineage for d3axaa_ (3axa A:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (47 proteins)
   Pfam PF00595

6. Protein automated matches [190055] (6 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [189198] (3 PDB entries)

8. Domain d3axaa_: 3axa A: [231813]
   automated match to d3axab_

Details for d3axaa_

PDB Entry: 3axa, 2.78 Å

PDB Description: crystal structure of afadin pdz domain in complex with the c-terminal peptide from nectin-3

PDB Compounds: (A:) Afadin, Nectin-3

SCOPe Domain Sequences for d3axaa_:

Sequence; same for both SEQRES and ATOM records:

>d3axaa_ b.36.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
peiitvtlkkqngmglsivaakgagqdklgiyvksvvkggaadvdgrlaagdqllsvdgr
slvglsqeraaelmtrtssvvtlevakqgairrewyv

Timeline for d3axaa_:

• d3axaa_ is new in SCOPe 2.03-stable
  
• d3axaa_ appears in SCOPe 2.04
  
• d3axaa_ appears in the current release, SCOPe 2.08