SCOPe 2.08: Domain d3av3a1: 3av3 A:1-187

Lineage for d3av3a1 (3av3 A:1-187)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.65: Formyltransferase [53327] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214567; strand 6 is antiparallel to the rest

4. Superfamily c.65.1: Formyltransferase [53328] (2 families)

5. Family c.65.1.0: automated matches [191608] (1 protein)
   not a true family

6. Protein automated matches [191110] (11 species)
   not a true protein

7. Species Geobacillus kaustophilus [TaxId:235909] [231809] (1 PDB entry)

8. Domain d3av3a1: 3av3 A:1-187 [231810]
   Other proteins in same PDB: d3av3a2
   automated match to d4ds3a_
   complexed with mg

Details for d3av3a1

PDB Entry: 3av3, 1.7 Å

PDB Description: Crystal structure of glycinamide ribonucleotide transformylase 1 from Geobacillus kaustophilus

PDB Compounds: (A:) phosphoribosylglycinamide formyltransferase

SCOPe Domain Sequences for d3av3a1:

Sequence; same for both SEQRES and ATOM records:

>d3av3a1 c.65.1.0 (A:1-187) automated matches {Geobacillus kaustophilus [TaxId: 235909]}
mkrlavfasgsgtnfqaivdaakrgdlparvallvcdrpgakvieraarenvpafvfspk
dypskaafeseilrelkgrqidwialagymrligptllsayegkivnihpsllpafpgkd
aigqayragvsetgvtvhyvdegmdtgpviaqrvvpivpgepiealeerihqvehelypt
vlrmllg

Timeline for d3av3a1:

• d3av3a1 first appeared in SCOPe 2.03, called d3av3a_
  
• d3av3a1 appears in SCOPe 2.07