Lineage for d3av3a1 (3av3 A:1-187)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892510Fold c.65: Formyltransferase [53327] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214567; strand 6 is antiparallel to the rest
  4. 2892511Superfamily c.65.1: Formyltransferase [53328] (2 families) (S)
  5. 2892629Family c.65.1.0: automated matches [191608] (1 protein)
    not a true family
  6. 2892630Protein automated matches [191110] (11 species)
    not a true protein
  7. 2892656Species Geobacillus kaustophilus [TaxId:235909] [231809] (1 PDB entry)
  8. 2892657Domain d3av3a1: 3av3 A:1-187 [231810]
    Other proteins in same PDB: d3av3a2
    automated match to d4ds3a_
    complexed with mg

Details for d3av3a1

PDB Entry: 3av3 (more details), 1.7 Å

PDB Description: Crystal structure of glycinamide ribonucleotide transformylase 1 from Geobacillus kaustophilus
PDB Compounds: (A:) phosphoribosylglycinamide formyltransferase

SCOPe Domain Sequences for d3av3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3av3a1 c.65.1.0 (A:1-187) automated matches {Geobacillus kaustophilus [TaxId: 235909]}
mkrlavfasgsgtnfqaivdaakrgdlparvallvcdrpgakvieraarenvpafvfspk
dypskaafeseilrelkgrqidwialagymrligptllsayegkivnihpsllpafpgkd
aigqayragvsetgvtvhyvdegmdtgpviaqrvvpivpgepiealeerihqvehelypt
vlrmllg

SCOPe Domain Coordinates for d3av3a1:

Click to download the PDB-style file with coordinates for d3av3a1.
(The format of our PDB-style files is described here.)

Timeline for d3av3a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3av3a2