Lineage for d1d5ra1 (1d5r A:188-351)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2038038Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2038039Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families) (S)
    two constituent families are related by circular permutation
  5. 2038040Family b.7.1.1: PLC-like (P variant) [49563] (12 protein domains)
  6. 2038156Protein Pten tumor suppressor (Phoshphoinositide phosphatase), C-terminal domain [49568] (1 species)
  7. 2038157Species Human (Homo sapiens) [TaxId:9606] [49569] (1 PDB entry)
  8. 2038158Domain d1d5ra1: 1d5r A:188-351 [23181]
    Other proteins in same PDB: d1d5ra2
    complexed with tla

Details for d1d5ra1

PDB Entry: 1d5r (more details), 2.1 Å

PDB Description: crystal structure of the pten tumor suppressor
PDB Compounds: (A:) phosphoinositide phosphotase pten

SCOPe Domain Sequences for d1d5ra1:

Sequence, based on SEQRES records: (download)

>d1d5ra1 b.7.1.1 (A:188-351) Pten tumor suppressor (Phoshphoinositide phosphatase), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
yrpvallfhkmmfetipmfsggtcnpqfvvcqlkvkiyssnsgptrredkfmyfefpqpl
pvcgdikveffhkqnkmlkkdkmfhfwvntffipgpeevdndkeylvltltkndldkank
dkanryfspnfkvklyftktv

Sequence, based on observed residues (ATOM records): (download)

>d1d5ra1 b.7.1.1 (A:188-351) Pten tumor suppressor (Phoshphoinositide phosphatase), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
yrpvallfhkmmfetipmfsggtcnpqfvvcqlkvkiyssnsgptrredkfmyfefpqpl
pvcgdikveffhkqnkmlkkdkmfhfwvntffipkeylvltltkndldkankdkanryfs
pnfkvklyftktv

SCOPe Domain Coordinates for d1d5ra1:

Click to download the PDB-style file with coordinates for d1d5ra1.
(The format of our PDB-style files is described here.)

Timeline for d1d5ra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1d5ra2