Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.131: DNA clamp [55978] (1 superfamily) contains two helices and two beta sheets duplication: fold has internal pseudo two-fold symmetry |
Superfamily d.131.1: DNA clamp [55979] (3 families) |
Family d.131.1.0: automated matches [227185] (1 protein) not a true family |
Protein automated matches [226907] (28 species) not a true protein |
Species Sulfolobus tokodaii [TaxId:273063] [231791] (2 PDB entries) |
Domain d3aizc2: 3aiz C:127-246 [231803] automated match to d2hiiy2 complexed with so4 |
PDB Entry: 3aiz (more details), 2.8 Å
SCOPe Domain Sequences for d3aizc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3aizc2 d.131.1.0 (C:127-246) automated matches {Sulfolobus tokodaii [TaxId: 273063]} efpfkakaltvtftdiideiediggdsitfkaeggklylsansdmgsstielstenggll eseggdaesvygleyvvntskmrkpsdtveiafgsqiplklrynlpqggyadfyiaprae
Timeline for d3aizc2: