Class b: All beta proteins [48724] (177 folds) |
Fold b.7: C2 domain-like [49561] (5 superfamilies) sandwich; 8 strands in 2 sheets; greek-key |
Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families) two constituent families are related by circular permutation |
Family b.7.1.1: PLC-like (P variant) [49563] (12 proteins) |
Protein Domain from cytosolic phospholipase A2 [49566] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [49567] (3 PDB entries) |
Domain d1bcia_: 1bci A: [23180] complexed with ca |
PDB Entry: 1bci (more details)
SCOPe Domain Sequences for d1bcia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bcia_ b.7.1.1 (A:) Domain from cytosolic phospholipase A2 {Human (Homo sapiens) [TaxId: 9606]} yshkftvvvlratkvtkgafgdmldtpdpyvelfisttpdsrkrtrhfnndinpvwnetf efildpnqenvleitlmdanyvmdetlgtatftvssmkvgekkevpfifnqvtemvlems lev
Timeline for d1bcia_: