SCOPe 2.05: Domain d3aj5b1: 3aj5 B:4-148

Lineage for d3aj5b1 (3aj5 B:4-148)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.2: Ricin B-like lectins [50370] (4 families)

5. Family b.42.2.1: Ricin B-like [50371] (11 proteins)

6. Protein automated matches [190608] (3 species)
   not a true protein

7. Species Clostridium botulinum [TaxId:1491] [230685] (3 PDB entries)

8. Domain d3aj5b1: 3aj5 B:4-148 [231796]
   automated match to d1qxma1
   complexed with nga

Details for d3aj5b1

PDB Entry: 3aj5, 1.8 Å

PDB Description: ha1 (ha33) subcomponent of botulinum type c progenitor toxin complexed with n-acetylgalactosamine, bound at site ii

PDB Compounds: (B:) Main hemagglutinin component

SCOPe Domain Sequences for d3aj5b1:

Sequence; same for both SEQRES and ATOM records:

>d3aj5b1 b.42.2.1 (B:4-148) automated matches {Clostridium botulinum [TaxId: 1491]}
tnandlrnnevffispsnntnkvldkisqsevklwnklsganqkwrliydtnkqaykikv
mdntsliltwnaplssvsvktdtngdnqywyllqnyisrnviirnymnpnlvlqyniddt
lmvstqtsssnqffkfsnciyealn

Timeline for d3aj5b1:

• d3aj5b1 first appeared in SCOPe 2.03
  
• d3aj5b1 appears in SCOPe 2.04
  
• d3aj5b1 appears in SCOPe 2.06
  
• d3aj5b1 appears in the current release, SCOPe 2.08