Class b: All beta proteins [48724] (176 folds) |
Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) |
Family b.42.2.1: Ricin B-like [50371] (11 proteins) |
Protein automated matches [190608] (3 species) not a true protein |
Species Clostridium botulinum [TaxId:1491] [230685] (3 PDB entries) |
Domain d3aj5b1: 3aj5 B:4-148 [231796] automated match to d1qxma1 complexed with nga |
PDB Entry: 3aj5 (more details), 1.8 Å
SCOPe Domain Sequences for d3aj5b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3aj5b1 b.42.2.1 (B:4-148) automated matches {Clostridium botulinum [TaxId: 1491]} tnandlrnnevffispsnntnkvldkisqsevklwnklsganqkwrliydtnkqaykikv mdntsliltwnaplssvsvktdtngdnqywyllqnyisrnviirnymnpnlvlqyniddt lmvstqtsssnqffkfsnciyealn
Timeline for d3aj5b1: