SCOPe 2.08: Domain d3aizd1: 3aiz D:1-126

Lineage for d3aizd1 (3aiz D:1-126)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.131: DNA clamp [55978] (1 superfamily)
   contains two helices and two beta sheets
   duplication: fold has internal pseudo two-fold symmetry

4. Superfamily d.131.1: DNA clamp [55979] (3 families)

5. Family d.131.1.0: automated matches [227185] (1 protein)
   not a true family

6. Protein automated matches [226907] (28 species)
   not a true protein

7. Species Sulfolobus tokodaii [TaxId:273063] [231791] (2 PDB entries)

8. Domain d3aizd1: 3aiz D:1-126 [231794]
   automated match to d2hiiy1
   complexed with so4

Details for d3aizd1

PDB Entry: 3aiz, 2.8 Å

PDB Description: Crystal structure of PCNA2-PCNA3 complex from Sulfolobus tokodaii (P21212)

PDB Compounds: (D:) DNA polymerase sliding clamp c

SCOPe Domain Sequences for d3aizd1:

Sequence; same for both SEQRES and ATOM records:

>d3aizd1 d.131.1.0 (D:1-126) automated matches {Sulfolobus tokodaii [TaxId: 273063]}
mrvkvidadafsyifrtleefideitldftsdglkirgidpsrvtfidilipagyfeeyn
vekeekvgvkledftdvlktvtkndslyletdenqnikvtldgvyertftfpsivaseie
tpnlnl

Timeline for d3aizd1:

• d3aizd1 first appeared in SCOPe 2.03
  
• d3aizd1 appears in SCOPe 2.07