Lineage for d3aa7b_ (3aa7 B:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3020312Fold e.43: Subunits of heterodimeric actin filament capping protein Capz [90095] (1 superfamily)
    3 domains: (1) protozoan pheromone-like alpha-helical bundle; (2) rubredoxin-like domain lacking metal-binding site; (3) alpha+beta heterodimerisation domain: alpha-beta(5)-alpha
  4. 3020313Superfamily e.43.1: Subunits of heterodimeric actin filament capping protein Capz [90096] (3 families) (S)
  5. 3020330Family e.43.1.2: Capz beta-1 subunit [90100] (2 proteins)
    automatically mapped to Pfam PF01115
  6. 3020331Protein Capz beta-1 subunit [90101] (1 species)
  7. 3020332Species Chicken (Gallus gallus) [TaxId:9031] [90102] (8 PDB entries)
  8. 3020333Domain d3aa7b_: 3aa7 B: [231786]
    Other proteins in same PDB: d3aa7a_
    automated match to d3lk3b_
    complexed with ba, mes

Details for d3aa7b_

PDB Entry: 3aa7 (more details), 1.9 Å

PDB Description: Crystal structure of Actin capping protein
PDB Compounds: (B:) F-actin-capping protein subunit beta isoforms 1 and 2

SCOPe Domain Sequences for d3aa7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3aa7b_ e.43.1.2 (B:) Capz beta-1 subunit {Chicken (Gallus gallus) [TaxId: 9031]}
sdqqldcaldlmrrlppqqieknlsdlidlvpslcedllssvdqplkiardkvvgkdyll
cdynrdgdsyrspwsnkydppledgampsarlrkleveannafdqyrdlyfeggvssvyl
wdldhgfagvilikkagdgskkikgcwdsihvvevqekssgrtahykltstvmlwlqtnk
tgsgtmnlggsltrqmekdetvsdssphianigrlvedmenkirstlneiyfgktkdivn
glr

SCOPe Domain Coordinates for d3aa7b_:

Click to download the PDB-style file with coordinates for d3aa7b_.
(The format of our PDB-style files is described here.)

Timeline for d3aa7b_: