Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
Fold e.43: Subunits of heterodimeric actin filament capping protein Capz [90095] (1 superfamily) 3 domains: (1) protozoan pheromone-like alpha-helical bundle; (2) rubredoxin-like domain lacking metal-binding site; (3) alpha+beta heterodimerisation domain: alpha-beta(5)-alpha |
Superfamily e.43.1: Subunits of heterodimeric actin filament capping protein Capz [90096] (3 families) |
Family e.43.1.2: Capz beta-1 subunit [90100] (2 proteins) automatically mapped to Pfam PF01115 |
Protein Capz beta-1 subunit [90101] (1 species) |
Species Chicken (Gallus gallus) [TaxId:9031] [90102] (8 PDB entries) |
Domain d3aa7b_: 3aa7 B: [231786] Other proteins in same PDB: d3aa7a_ automated match to d3lk3b_ complexed with ba, mes |
PDB Entry: 3aa7 (more details), 1.9 Å
SCOPe Domain Sequences for d3aa7b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3aa7b_ e.43.1.2 (B:) Capz beta-1 subunit {Chicken (Gallus gallus) [TaxId: 9031]} sdqqldcaldlmrrlppqqieknlsdlidlvpslcedllssvdqplkiardkvvgkdyll cdynrdgdsyrspwsnkydppledgampsarlrkleveannafdqyrdlyfeggvssvyl wdldhgfagvilikkagdgskkikgcwdsihvvevqekssgrtahykltstvmlwlqtnk tgsgtmnlggsltrqmekdetvsdssphianigrlvedmenkirstlneiyfgktkdivn glr
Timeline for d3aa7b_: