Lineage for d3a8kb1 (3a8k B:1-276)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1946403Fold d.250: Folate-binding domain [103024] (1 superfamily)
    duplication: consists of two beta(2)-alpha-beta(3)-alpha subdomains swapped with the first strands
  4. 1946404Superfamily d.250.1: Folate-binding domain [103025] (2 families) (S)
    some topological similarity to Formylmethanofuran:tetrahydromethanopterin formyltransferase
  5. 1946405Family d.250.1.1: Aminomethyltransferase folate-binding domain [103026] (4 proteins)
  6. 1946429Protein automated matches [231765] (1 species)
    not a true protein
  7. 1946430Species Escherichia coli K-12 [TaxId:83333] [231766] (3 PDB entries)
  8. 1946432Domain d3a8kb1: 3a8k B:1-276 [231780]
    Other proteins in same PDB: d3a8ka2, d3a8kb2, d3a8kc2, d3a8kd2, d3a8ke_, d3a8kf_
    automated match to d1vloa2

Details for d3a8kb1

PDB Entry: 3a8k (more details), 1.95 Å

PDB Description: crystal structure of etd97n-ehred complex
PDB Compounds: (B:) Aminomethyltransferase

SCOPe Domain Sequences for d3a8kb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3a8kb1 d.250.1.1 (B:1-276) automated matches {Escherichia coli K-12 [TaxId: 83333]}
aqqtplyeqhtlcgarmvdfhgwmmplhygsqidehhavrtdagmfdvshmtivdlrgsr
treflryllandvakltksgkalysgmlnasggvidnlivyyftedffrlvvnsatrekd
lswitqhaepfgieitvrddlsmiavqgpnaqakaatlfndaqrqavegmkpffgvqagd
lfiattgytgeagyeialpnekaadfwralveagvkpcglgardtlrleagmnlygqemd
etisplaanmgwtiawepadrdfigrealevqrehg

SCOPe Domain Coordinates for d3a8kb1:

Click to download the PDB-style file with coordinates for d3a8kb1.
(The format of our PDB-style files is described here.)

Timeline for d3a8kb1: